Germany
Japan
United Kingdom
China
Goat Anti-TAF7L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NHFQSVLEQLELQEK, from the internal region (near C Terminus) of the protein sequence according to NP_079161.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Taf7l Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Taf7l antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Taf7l. Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ |
Rabbit Polyclonal Anti-TAF7L Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF7L antibody: synthetic peptide directed towards the middle region of mouse TAF7L. Synthetic peptide located within the following region: DEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKL |
Rabbit Polyclonal Anti-TAF7L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF7L Antibody: synthetic peptide directed towards the middle region of human TAF7L. Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ |
TAF7L Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TAF7L |
TAF7L Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TAF7L