ZNF148 Rabbit Polyclonal Antibody

CAT#: TA335485

Rabbit Polyclonal Anti-ZNF148 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZNF148"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF148 Antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 89 kDa
Gene Name zinc finger protein 148
Background ZNF148 is involved in transcriptional regulation. ZNF148 represses the transcription of a number of genes including gastrin, stromelysin and enolase. ZNF148 binds to the G-rich box in the enhancer region of these genes.
Synonyms BERF-1; BFCOL1; HT-BETA; pHZ-52; ZBP-89; ZFP148
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.