ATG16L1 Rabbit Polyclonal Antibody

CAT#: TA335528

Rabbit Polyclonal Anti-ATG16L1 Antibody

Product Images

WB Suggested Anti-ATG16L1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: ATG16L1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the N terminal of human ATG16L1. Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: autophagy related 16 like 1
• Database Link:
  NP_060444
  Entrez Gene 55054 Human
  UniProt ID Q676U5
• Background: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]). [supplied by OMIM]
• Synonyms: APG16L; ATG16A; ATG16L; IBD10; WDR30
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Rabbit: 91%