LARP1 Rabbit Polyclonal Antibody

CAT#: TA335599

Rabbit Polyclonal Anti-LARP1 Antibody

Product Images

WB Suggested Anti-LARP2 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate. LARP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Human Brain

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LARP2 Antibody: synthetic peptide directed towards the middle region of human LARP2. Synthetic peptide located within the following region: RNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 116 kDa
• Gene Name: La ribonucleoprotein domain family member 1
• Database Link:
  NP_056130
  Entrez Gene 23367 Human
  UniProt ID Q6PKG0
• Background: LARP2 encodes a protein containing domains found in the La related protein of Drosophila melanogaster. La motif-containing proteins are thought to be RNA-binding proteins, where the La motif and adjacent amino acids fold into an RNA recognition motif. The La motif is also found in proteins unrelated to the La protein. Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described.
• Synonyms: LARP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 79%