Rabbit Polyclonal Anti-LARP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LARP1 antibody: synthetic peptide directed towards the N terminal of human LARP1. Synthetic peptide located within the following region: KGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQQERESPRPLQLPGAE |
Rabbit Polyclonal Anti-LARP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LARP1 antibody: synthetic peptide directed towards the N terminal of human LARP1. Synthetic peptide located within the following region: HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN |
Rabbit Polyclonal Anti-LARP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LARP1 antibody: synthetic peptide directed towards the N terminal of human LARP1. Synthetic peptide located within the following region: MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPD |
Rabbit Polyclonal Anti-LARP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LARP2 Antibody: synthetic peptide directed towards the middle region of human LARP2. Synthetic peptide located within the following region: RNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPP |
LARP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human LARP1 |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
