LARP1 Rabbit Polyclonal Antibody

CAT#: TA343964

Rabbit Polyclonal Anti-LARP1 Antibody

Product Images

WB Suggested Anti-LARP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LARP1 antibody: synthetic peptide directed towards the N terminal of human LARP1. Synthetic peptide located within the following region: HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 116 kDa
• Gene Name: La ribonucleoprotein domain family member 1
• Database Link:
  NP_056130
  Entrez Gene 23367 Human
  UniProt ID Q6PKG0
• Background: LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.
• Synonyms: LARP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%