PHF16 (JADE3) Rabbit Polyclonal Antibody

CAT#: TA335612

Rabbit Polyclonal Anti-PHF16 Antibody

Product Images

WB Suggested Anti-PHF16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

• 

  Rabbit Anti-PHF16 Antibody; Paraffin Embedded Tissue: Human bronchiole epithelium; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PHF16 Antibody: synthetic peptide directed towards the middle region of human PHF16. Synthetic peptide located within the following region: KSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: jade family PHD finger 3
• Database Link:
  NP_055550
  Entrez Gene 9767 Human
  UniProt ID Q92613
• Background: This gene is part of a gene cluster on chromosome Xp11.23. PHF16 contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known.This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein.
• Synonyms: JADE-3; PHF16
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Dog: 85%; Horse: 85%; Mouse: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors