RBPSUHL (RBPJL) Rabbit Polyclonal Antibody

CAT#: TA335630

Rabbit Polyclonal Anti-RBPJL Antibody

Product Images

WB Suggested Anti-RBPJL Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RBPJL Antibody: synthetic peptide directed towards the N terminal of human RBPJL. Synthetic peptide located within the following region: AHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: recombination signal binding protein for immunoglobulin kappa J region like
• Database Link:
  NP_055091
  Entrez Gene 11317 Human
  UniProt ID Q9UBG7
• Background: In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPSUHL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). The protein encoded by this gene is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.
• Synonyms: RBPL; RBPSUHL; SUHL
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Notch signaling pathway