RNF2 Rabbit Polyclonal Antibody

CAT#: TA335663

Rabbit Polyclonal Anti-RNF2 Antibody

Product Images

WB Suggested Anti-RNF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Daudi cell lysate; RNF2 is supported by BioGPS gene expression data to be expressed in Daudi

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RNF2 Antibody: synthetic peptide directed towards the middle region of human RNF2. Synthetic peptide located within the following region: NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: ring finger protein 2
• Database Link:
  NP_009143
  Entrez Gene 6045 Human
  UniProt ID Q99496
• Background: Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by RNF2 is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.
• Synonyms: BAP-1; BAP1; DING; HIPI3; RING1B; RING2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors