ATG5 Rabbit Polyclonal Antibody

CAT#: TA335734

Rabbit Polyclonal Anti-ATG5 Antibody

Product Images

WB Suggested Anti-ATG5 Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: ATG5; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ATG5; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ATG5; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Human Placenta

• 

  Human Prostate

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: autophagy related 5
• Database Link:
  NP_004840
  Entrez Gene 9474 Human
  UniProt ID Q9H1Y0
• Background: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.
• Synonyms: APG5; APG5-LIKE; APG5L; ASP; hAPG5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Regulation of autophagy, RIG-I-like receptor signaling pathway