ASH2L Rabbit Polyclonal Antibody

CAT#: TA335740

Rabbit Polyclonal Anti-ASH2L Antibody

Product Images

WB Suggested Anti-ASH2L Antibody; Titration: 2.5 ug/ml; Positive Control: Jurkat Whole Cell; ASH2L is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-ASH2L antibody; Paraffin Embedded Tissue: Human Heart cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: ASH2 like histone lysine methyltransferase complex subunit
• Database Link:
  NP_004665
  Entrez Gene 9070 Human
  UniProt ID Q9UBL3
• Background: ASH2L plays a role in hematopoiesis and is associated with some special kinds of leukemia. The amount of ASH2L transcripts is extremely high in fetal liver, testis, and leukemia cell lines with erythroid and megakaryocytic potential.
• Synonyms: ASH2; ASH2L1; ASH2L2; Bre2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors