HOXB7 Rabbit Polyclonal Antibody

CAT#: TA335745

Rabbit Polyclonal Anti-HOXB7 Antibody

Product Images

WB Suggested Anti-HOXB7 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

• 

  Sample Type. HCT116; Primary Antibody Dilution. 4 ug/ml; Secondary Antibody. Anti-rabbit Alexa 546; Secondary Antibody Dilution. 2 ug/ml; Gene Name. HOXB7

• 

  Sample Type. SKOV3; Primary Antibody Dilution. 4 ug/ml; Secondary Antibody. Anti-rabbit Alexa 546; Secondary Antibody Dilution. 2 ug/ml; Gene Name. HOXB7

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HOXB7 Antibody: synthetic peptide directed towards the C terminal of human HOXB7. Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: homeobox B7
• Database Link:
  NP_004493
  Entrez Gene 3217 Human
  UniProt ID P09629
• Background: HOXB7 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXBThis gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.
• Synonyms: HHO.C1; Hox-2.3; HOX2; HOX2C
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Mouse: 92%; Rat: 85%; Horse: 79%; Dog: 77%

Reference Data

• Protein Families: Transcription Factors