TRIP15 (COPS2) Rabbit Polyclonal Antibody

CAT#: TA335759

Rabbit Polyclonal Anti-COPS2 Antibody

Product Images

WB Suggested Anti-COPS2 Antibody Titration: 0.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

• 

  Sample Type: 1. Markers; 2. B8 mouse fibroblast cells, extraction only; 3. Human total cell extract; 4. Human blood cells, partially purified; 5. Pombe, extraction only; Primary Dilution: 1:200; Secondary Anitbody: HRP conjugated anti-rabbit; Image Submitted By: Dr. Elah Pick; University of Haifa at Oranim

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-COPS2 Antibody: synthetic peptide directed towards the N terminal of human COPS2. Synthetic peptide located within the following region: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: COP9 signalosome subunit 2
• Database Link:
  NP_004227
  Entrez Gene 12848 MouseEntrez Gene 9318 Human
  UniProt ID P61201
• Background: COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/Ion ChannelSBP. COPS2 is also innvolved in early stage of neuronal differentiation via its interaction with NIF3L1.
• Synonyms: ALIEN; CSN2; SGN2; TRIP15
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 91%; Yeast: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors