SPI1 Rabbit Polyclonal Antibody

CAT#: TA335785

Rabbit Polyclonal Anti-SPI1 Antibody

Product Images

WB Suggested Anti-SPI1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPI1 Antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: Spi-1 proto-oncogene
• Database Link:
  NP_003111
  Entrez Gene 6688 Human
  UniProt ID P17947
• Background: SPI1 is known to collaborate with multiple transcription factors and to regulate expression of immunoglobulin genes. Lack of SPI1 expression is associated with defective immunoglobulin transcription in Hodgkin and Reed-Sternberg cells of classical Hodgkin disease. This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: OF; PU.1; SFPI1; SPI-1; SPI-A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Pathways in cancer