PITX1 Rabbit Polyclonal Antibody

CAT#: TA335812

Rabbit Polyclonal Anti-PITX1 Antibody

Product Images

WB Suggested Anti-PITX1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PITX1 Antibody: synthetic peptide directed towards the C terminal of human PITX1. Synthetic peptide located within the following region: GTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: paired like homeodomain 1
• Database Link:
  NP_002644
  Entrez Gene 18740 MouseEntrez Gene 5307 Human
  UniProt ID P78337
• Background: PITX1 is a member of the RIEG/PITX homeobox family, which is involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.
• Synonyms: BFT; CCF; LBNBG; POTX; PTX1
• Note: Immunogen Sequence Homology: Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors