NEUROD1 Rabbit Polyclonal Antibody

CAT#: TA335825

Rabbit Polyclonal Anti-NEUROD1 Antibody

Product Images

WB Suggested Anti-NEUROD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NEUROD1 Antibody: synthetic peptide directed towards the middle region of human NEUROD1. Synthetic peptide located within the following region: ATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: neuronal differentiation 1
• Database Link:
  NP_002491
  Entrez Gene 4760 Human
  UniProt ID Q13562
• Background: NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation. This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: BETA2; BHF-1; bHLHa3; MODY6; NEUROD
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young