MUM1 (IRF4) Rabbit Polyclonal Antibody

CAT#: TA335827

Rabbit Polyclonal Anti-IRF4 Antibody

Product Images

WB Suggested Anti-IRF4 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Skin

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: interferon regulatory factor 4
• Database Link:
  NP_002451
  Entrez Gene 3662 Human
  UniProt ID Q15306
• Background: IFN regulatory factor (IRF)-4 is a lymphoid/myeloid-restricted member of the IRF transcription factor family that plays an essential role in the homeostasis and function of mature lymphocytes. IRF-4 expression is tightly regulated in resting primary T cells and is transiently induced at the mRNA and protein levels after activation by Ag-mimetic stimuli such as TCR cross-linking or treatment with phorbol ester and calcium ionophore (PMA/ionomycin).
• Synonyms: LSIRF; MUM1; NF-EM5; SHEP8
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors