MUM1 (IRF4) Rabbit Polyclonal Antibody

CAT#: TA335828

Rabbit Polyclonal Anti-IRF4 Antibody

Product Images

Host: Rabbit; Target Name: IRF4; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-IRF4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate. IRF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the middle region of human IRF4. Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: interferon regulatory factor 4
• Database Link:
  NP_002451
  Entrez Gene 3662 Human
  UniProt ID Q15306
• Background: IRF4 is a transcriptional activator. It binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter.It also binds the immunoglobulin lambda light chain enhancer, together with PU.1. IRF4 probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells.
• Synonyms: LSIRF; MUM1; NF-EM5; SHEP8
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors