MGAT2 Rabbit Polyclonal Antibody

CAT#: TA335834

Rabbit Polyclonal Anti-MGAT2 Antibody

Product Images

WB Suggested Anti-MGAT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate. MGAT2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MGAT2 Antibody: synthetic peptide directed towards the middle region of human MGAT2. Synthetic peptide located within the following region: YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
• Database Link:
  NP_002399
  Entrez Gene 4247 Human
  UniProt ID Q10469
• Background: MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The coding region of this gene is intronless. Transcript variants with a spliced 5' UTR may exist, but their biological validity has not been determined.
• Synonyms: CDG2A; CDGS2; GLCNACTII; GNT-II; GNT2
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis