Choline kinase alpha (CHKA) Rabbit Polyclonal Antibody

CAT#: TA335874

Rabbit Polyclonal Anti-CHKA Antibody

Product Images

WB Suggested Anti-CHKA Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

• 

  2Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CHKA Antibody: synthetic peptide directed towards the middle region of human CHKA. Synthetic peptide located within the following region: LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: choline kinase alpha
• Database Link:
  NP_001268
  Entrez Gene 1119 Human
  UniProt ID P35790
• Background: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: CHK; CK; CKI; EK
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways