CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody

CAT#: TA335898

Rabbit Polyclonal Anti-CIZ1 Antibody

Product Images

WB Suggested Anti-CIZ1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HT1080 cell lysate; CIZ1 is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CIZ1 Antibody: synthetic peptide directed towards the middle region of human CIZ1. Synthetic peptide located within the following region: YICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPTTRPVSRRC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: CDKN1A interacting zinc finger protein 1
• Database Link:
  NP_001124490
  Entrez Gene 25792 Human
  UniProt ID Q9ULV3
• Background: CIZ1 may regulate the subcellular localization of CIP/WAF1.
• Synonyms: LSFR1; NP94; ZNF356
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%