USD 475.00
5 Days
Rabbit Polyclonal Anti-CIZ1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIZ1 antibody: synthetic peptide directed towards the C terminal of human CIZ1. Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CIZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CIZ1 Antibody: synthetic peptide directed towards the middle region of human CIZ1. Synthetic peptide located within the following region: YICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPTTRPVSRRC |
USD 345.00
In Stock
Rabbit Polyclonal Anti-CIZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CIZ1 |
USD 220.00
3 Weeks
CIZ1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-440 of human CIZ1 (NP_001124490). |
Germany
Japan
United Kingdom
China
