RALGDS Rabbit Polyclonal Antibody

CAT#: TA335961

Rabbit Polyclonal Anti-RALGDS Antibody

Product Images

WB Suggested Anti-RALGDS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RALGDS Antibody: synthetic peptide directed towards the N terminal of human RALGDS. Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: ral guanine nucleotide dissociation stimulator
• Database Link:
  NP_001035827
  Entrez Gene 5900 Human
  UniProt ID Q12967
• Background: The specific function of this protein remains unknown.
• Synonyms: RalGEF; RGDS; RGF
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: Colorectal cancer, Pancreatic cancer, Pathways in cancer