SI Rabbit Polyclonal Antibody

CAT#: TA335962

Rabbit Polyclonal Anti-SI Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SI Antibody: synthetic peptide directed towards the N terminal of human SI. Synthetic peptide located within the following region: NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 209 kDa
Gene Name sucrase-isomaltase
Background SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.
Synonyms MGC131621; MGC131622
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Zebrafish: 77%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Starch and sucrose metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.