GALNTL6 Rabbit Polyclonal Antibody

CAT#: TA336022

Rabbit Polyclonal Anti-GALNTL6 Antibody

Product Images

Host: Rabbit; Target Name: GALNTL6; Sample Tissue: THP-1 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GALNTL6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GALNTL6. Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: polypeptide N-acetylgalactosaminyltransferase-like 6
• Database Link:
  NP_001030017
  Entrez Gene 442117 Human
  UniProt ID Q49A17
• Background: GALNTL6 catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
• Synonyms: GalNAc-T6L; GALNACT20; GALNT17
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Zebrafish: 93%; Horse: 83%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis