PBLD Rabbit Polyclonal Antibody

CAT#: TA336026

Rabbit Polyclonal Anti-PBLD Antibody

Product Images

WB Suggested Anti-PBLD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PBLD Antibody: synthetic peptide directed towards the N terminal of human PBLD. Synthetic peptide located within the following region: KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: phenazine biosynthesis like protein domain containing
• Database Link:
  NP_001028255
  Entrez Gene 64081 Human
  UniProt ID P30039
• Background: The function of the PBLD protein remains unknown.
• Synonyms: HEL-S-306; MAWBP; MAWDBP
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 86%; Yeast: 79%