CPT1A Rabbit Polyclonal Antibody

CAT#: TA336036

Rabbit Polyclonal Anti-CPT1A Antibody

Product Images

WB Suggested Anti-CPT1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate

• 

  Lanes: 1. 45ug capan1 cell lysate; 2. 45 ug HPAF cell lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-Rabbit HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: CPT1A; Submitted by: Dr. Pankaj Singh, UNMC, Omaha, NE;

• 

  Host: Rabbit; Target Name: CPT1A; Sample Tissue: 293T; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 0.12

• 

  Sample Type: Human Capan1 cells (Pancreatic cancer cell line) Primary Antibody Dilution: 1: 300; Secondary Antibody: Anti-rabbit-AlexaFluor-488; Secondary Antibody: ilution: 1: 200; Color/Signal Descriptions: CPT1A: Green DAPI: Blue; Gene Name: CPT1A; Submitted by: Dr. Pankaj Singh, UNMC, Omaha, NE

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CPT1A Antibody: synthetic peptide directed towards the middle region of human CPT1A. Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: carnitine palmitoyltransferase 1A
• Database Link:
  NP_001027017
  Entrez Gene 1374 Human
  UniProt ID P50416
• Background: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: CPT1; CPT1-L; L-CPT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Fatty acid metabolism, PPAR signaling pathway