GASK1B Rabbit Polyclonal Antibody

CAT#: TA336039

Rabbit Polyclonal Anti-FAM198B Antibody

Product Images

Host: Rabbit; Target Name: FAM198B; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM198B Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM198B. Synthetic peptide located within the following region: LAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: family with sequence similarity 198 member B
• Database Link:
  NP_001026870
  Entrez Gene 51313 Human
  UniProt ID Q6UWH4
• Background: The function of this protein remains unknown.
• Synonyms: AD021; AD036; C4orf18
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 91%; Dog: 86%; Zebrafish: 85%