ANO6 Rabbit Polyclonal Antibody
Other products for "ANO6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Ano6 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 106 kDa |
Gene Name | anoctamin 6 |
Database Link | |
Background | Ano6 may act as a calcium-activated chloride channel By similarity. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system. |
Synonyms | BDPLT7; SCTS; TMEM16F |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 77% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.