ANO6 Rabbit Polyclonal Antibody

CAT#: TA336048

Rabbit Polyclonal Anti-Ano6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ANO6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Ano6 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 106 kDa
Gene Name anoctamin 6
Background Ano6 may act as a calcium-activated chloride channel By similarity. It is essential for calcium-dependent exposure of phosphatidylserine on the surface of activated platelets, a process necessary to trigger the clotting system.
Synonyms BDPLT7; SCTS; TMEM16F
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 77%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.