TSPAN4 Rabbit Polyclonal Antibody

CAT#: TA336051

Rabbit Polyclonal Anti-TSPAN4 Antibody

Product Images

WB Suggested Anti-TSPAN4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TSPAN4 Antibody: synthetic peptide directed towards the middle region of human TSPAN4. Synthetic peptide located within the following region: YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: tetraspanin 4
• Database Link:
  NP_001020405
  Entrez Gene 7106 Human
  UniProt ID O14817
• Background: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: NAG-2; NAG2; TETRASPAN; TM4SF7; TSPAN-4
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Pig: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane