SC5DL (SC5D) Rabbit Polyclonal Antibody

CAT#: TA336055

Rabbit Polyclonal Anti-SC5DL Antibody

Product Images

WB Suggested Anti-SC5DL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SC5DL Antibody: synthetic peptide directed towards the N terminal of human SC5DL. Synthetic peptide located within the following region: NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: sterol-C5-desaturase
• Database Link:
  NP_001020127
  Entrez Gene 6309 Human
  UniProt ID O75845
• Background: SC5DL catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol.This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.
• Synonyms: ERG3; S5DES; SC5DL
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Steroid biosynthesis