TRIM17 Rabbit Polyclonal Antibody

CAT#: TA336056

Rabbit Polyclonal Anti-TRIM17 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TRIM17"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TRIM17 Antibody: synthetic peptide directed towards the middle region of human TRIM17. Synthetic peptide located within the following region: MKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPDATS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name tripartite motif containing 17
Background TRIM17 encodes a protein that is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed at high levels in the testis, but its function is unknown.
Synonyms RBCC; RNF16; terf
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 79%; Rat: 79%; Yeast: 79%; Bovine: 79%; Pig: 77%; Mouse: 77%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.