TRIM17 Rabbit Polyclonal Antibody

CAT#: TA336057

Rabbit Polyclonal Anti-TRIM17 Antibody

Product Images

WB Suggested Anti-TRIM17 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRIM17 Antibody: synthetic peptide directed towards the C terminal of human TRIM17. Synthetic peptide located within the following region: PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: tripartite motif containing 17
• Database Link:
  NP_001020111
  Entrez Gene 51127 Human
  UniProt ID Q9Y577
• Background: TRIM17 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene.
• Synonyms: RBCC; RNF16; terf
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome