PODXL Rabbit Polyclonal Antibody

CAT#: TA336066

Rabbit Polyclonal Anti-PODXL Antibody

Product Images

WB Suggested Anti-PODXL Antibody Titration: 0.5 ug/ml; Positive Control: Jurkat cell lysate

• 

  Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-PODXL antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the middle region of human PODXL. Synthetic peptide located within the following region: PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: podocalyxin like
• Database Link:
  NP_001018121
  Entrez Gene 5420 Human
  UniProt ID O00592
• Background: PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.
• Synonyms: Gp200; PC; PCLP; PCLP-1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane