IGSF11 Rabbit Polyclonal Antibody

CAT#: TA336080

Rabbit Polyclonal Anti-IGSF11 Antibody

Product Images

WB Suggested Anti-IGSF11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IGSF11 Antibody: synthetic peptide directed towards the middle region of human IGSF11. Synthetic peptide located within the following region: EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: immunoglobulin superfamily member 11
• Database Link:
  NP_001015887
  Entrez Gene 152404 Human
  UniProt ID Q5DX21
• Background: IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM). [supplied by OMIM]
• Synonyms: BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane