Aurora C (AURKC) Rabbit Polyclonal Antibody

CAT#: TA336082

Rabbit Polyclonal Anti-AURKC Antibody

Product Images

WB Suggested Anti-AURKC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Pancreas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AURKC Antibody: synthetic peptide directed towards the middle region of human AURKC. Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: aurora kinase C
• Database Link:
  NP_001015878
  Entrez Gene 6795 Human
  UniProt ID Q9UQB9
• Background: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.
• Synonyms: AIE2; AIK3; ARK3; AurC; aurora-C; HEL-S-90; SPGF5; STK13
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Goat: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase