RAP1A Rabbit Antibody

CAT#: TA336123

Rabbit Polyclonal Anti-Rap1a Antibody

Specifications

Product Data

• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-Rap1a Antibody is: synthetic peptide directed towards the middle region of Mouse Rap1a. Synthetic peptide located within the following region: DLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKC
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Database Link:
  NP_001010935
  Entrez Gene 109905 Mouse
• Background: Rap1a induces morphological reversion of a cell line transformed by a Ras oncogene. Rap1a counteracts the mitogenic function of Ras, at least partly because it can interact with Ras GAPs and RAF in a competitive manner.
• Synonyms: C21KG; G-22K; KREV-1; KREV1; RAP1; SMGP21
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Long-term potentiation, MAPK signaling pathway, Neurotrophin signaling pathway, Renal cell carcinoma