IMPDH2 Rabbit Polyclonal Antibody

CAT#: TA336212

Rabbit Polyclonal Anti-IMPDH2 Antibody

Product Images

WB Suggested Anti-IMPDH2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate. IMPDH2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56
• Gene Name: IMP (inosine 5'-monophosphate) dehydrogenase 2
• Database Link:
  NP_000875
  Entrez Gene 3615 Human
  UniProt ID P12268
• Background: IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.
• Synonyms: IMPD2; IMPDH-II
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism