DNA Ligase I (LIG1) Rabbit Polyclonal Antibody

CAT#: TA336236

Rabbit Polyclonal Anti-LIG1 Antibody

Product Images

WB Suggested Anti-LIG1 Antibody Titration: 0.2-1 ug/ml; Positive Control: A549 cell lysateLIG1 is supported by BioGPS gene expression data to be expressed in A549

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 102 kDa
• Gene Name: DNA ligase 1
• Database Link:
  NP_000225
  Entrez Gene 3978 Human
  UniProt ID P18858
• Background: LIG1is DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.
• Synonyms: MGC117397; MGC130025
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Dog: 92%; Horse: 92%; Pig: 92%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Base excision repair, DNA replication, Mismatch repair, Nucleotide excision repair