HMGCL Rabbit Polyclonal Antibody

CAT#: TA336239

Rabbit Polyclonal Anti-Hmgcl Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HMGCL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name 3-hydroxymethyl-3-methylglutaryl-CoA lyase
Background Hmgcl is an enzyme of the ketogenic 3-hydroxy-3-methylglutaryl-CoA cycle.
Synonyms HL
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.