Gelsolin (GSN) Rabbit Polyclonal Antibody

CAT#: TA336242

Rabbit Polyclonal Anti-GSN Antibody

Product Images

WB Suggested Anti-GSN Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

• 

  GSN antibody - C-terminal region validated by WB using pFA fixed human tonsil tissue

• 

  IHC Information: Paraffin embedded tonsil tissue, tested with an antibody Dilution of 5 ug/ml.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: gelsolin
• Database Link:
  NP_000168
  Entrez Gene 2934 Human
  UniProt ID P06396
• Background: GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
• Synonyms: ADF; AGEL
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton