TIP120A (CAND1) Rabbit Polyclonal Antibody

CAT#: TA337232

Rabbit Polyclonal Anti-CAND1 Antibody

Product Images

WB Suggested Anti-CAND1 Antibody ; Titration: 1 ug/ml; Positive Control: mouse testis

• 

  WB Suggested Anti-CAND1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAND1 antibody: synthetic peptide directed towards the middle region of human CAND1. Synthetic peptide located within the following region: AALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 136 kDa
• Gene Name: cullin associated and neddylation dissociated 1
• Database Link:
  NP_060918
  Entrez Gene 71902 MouseEntrez Gene 55832 Human
  UniProt ID Q86VP6
• Background: CAND1 enhances transcription from various types of promoters. It is a regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. CAND1 prevents neddylation of CUL1 by physically blocking access to the neddylation site. CAND1 disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins.
• Synonyms: TIP120; TIP120A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors