TIP120A (CAND1) Rabbit Polyclonal Antibody

CAT#: TA337233

Rabbit Polyclonal Anti-CAND1 Antibody

Product Images

WB Suggested Anti-TIP120A Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TIP120A antibody: synthetic peptide directed towards the N terminal of human TIP120A. Synthetic peptide located within the following region: TVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 136 kDa
• Gene Name: cullin associated and neddylation dissociated 1
• Database Link:
  NP_060918
  Entrez Gene 71902 MouseEntrez Gene 55832 Human
  UniProt ID Q86VP6
• Background: TIP120A functions as a negative regulator of SCF E3 ubiquitin ligases and may modulate other cullin ligases in a similar fashion.
• Synonyms: TIP120; TIP120A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors