DMTF1 Rabbit Polyclonal Antibody

CAT#: TA337244

Rabbit Polyclonal Anti-DMTF1 Antibody

Product Images

WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the C terminal of human DMTF1. Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: cyclin D binding myb like transcription factor 1
• Database Link:
  NP_066968
  Entrez Gene 9988 Human
  UniProt ID Q9Y222
• Background: DMTF1 binds specifically to the nonamer DNA consensus sequences CCCG(G/T)ATGT to activate transcription.
• Synonyms: DMP1; DMTF; hDMP1; MRUL
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Pig: 91%; Guinea pig: 91%

Reference Data

• Protein Families: Transcription Factors