C3IP1 (KLHL12) Rabbit Polyclonal Antibody

CAT#: TA337246

Rabbit Polyclonal Anti-KLHL12 Antibody

Product Images

Host: Rabbit; Target Name: KLHL12; Sample Tissue: Stomach Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KLHL12 antibody is: synthetic peptide directed towards the N-terminal region of Human KLHL12. Synthetic peptide located within the following region: EKGKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: kelch like family member 12
• Database Link:
  NP_067646
  Entrez Gene 59349 Human
  UniProt ID Q53G59
• Background: KLHL12 is a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of Wnt signaling pathway and ER-Golgi transport. The BCR(KLHL12) complex is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B). As part of the BCR(KLHL12) complex, also acts as a negative regulator of the Wnt signaling pathway by mediating ubiquitination and subsequent proteolysis of DVL3. The BCR(KLHL12) complex also mediates polyubiquitination of DRD4, without leading to degradation of DRD4.
• Synonyms: C3IP1; DKIR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%