ZNF148 Rabbit Polyclonal Antibody
Other products for "ZNF148"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF148 antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: RCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 89 kDa |
Gene Name | zinc finger protein 148 |
Database Link | |
Background | ZNF148 is involved in transcriptional regulation. ZNF148 represses the transcription of a number of genes including gastrin, stromelysin and enolase. ZNF148 binds to the G-rich box in the enhancer region of these genes. |
Synonyms | BERF-1; BFCOL1; HT-BETA; pHZ-52; ZBP-89; ZFP148 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Zebrafish: 85%; Yeast: 83% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.