HIST4H4 Rabbit Polyclonal Antibody

CAT#: TA337345

Rabbit Polyclonal Anti-HIST1H4A Antibody

Product Images

Host: Rabbit; Target Name: HIST1H4A; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HIST1H4A antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H4A. Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: histone cluster 4, H4
• Database Link:
  NP_778224
  Entrez Gene 121504 Human
  UniProt ID P62805
• Background: HIST1H4A is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
• Synonyms: H4; p
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Systemic lupus erythematosus