IFIT1 Rabbit Polyclonal Antibody

CAT#: TA337349

Rabbit Polyclonal Anti-IFIT1 Antibody

Product Images

Host: Rabbit; Target Name: IFIT1; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IFIT1 antibody is: synthetic peptide directed towards the middle region of Human IFIT1. Synthetic peptide located within the following region: PFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: interferon induced protein with tetratricopeptide repeats 1
• Database Link:
  NP_001539
  Entrez Gene 3434 Human
  UniProt ID P09914
• Background: This gene encodes a protein containing tetratricopeptide repeats that was originally identified as induced upon treatment with interferon. The encoded protein may inhibit viral replication and translational initiation. This gene is located in a cluster on chromosome 10 with five other closely related genes. There is a pseudogene for this gene on chromosome 13. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
• Synonyms: C56; G10P1; IFI-56; IFI-56K; IFI56; IFIT-1; IFNAI1; ISG56; P56; RNM561
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Rabbit: 92%; Dog: 85%; Horse: 85%