KIAA0664 (CLUH) Rabbit Polyclonal Antibody

CAT#: TA337378

Rabbit Polyclonal Anti-CLUH Antibody

Product Images

Host: Rabbit; Target Name: CLUH; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLUH antibody is: synthetic peptide directed towards the N-terminal region of Human CLUH. Synthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 146 kDa
• Gene Name: clustered mitochondria (cluA/CLU1) homolog
• Database Link:
  NP_056044
  Entrez Gene 23277 Human
  UniProt ID O75153
• Background: CLUH is involved in proper cytoplasmic distribution of mitochondria.
• Synonyms: CLU1; KIAA0664
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome