CYBB Rabbit Polyclonal Antibody

CAT#: TA337434

Rabbit Polyclonal Anti-CYBB Antibody

Product Images

Host: Rabbit; Target Name: CYBB; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB. Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: cytochrome b-245 beta chain
• Database Link:
  NP_000388
  Entrez Gene 1536 Human
  UniProt ID P04839
• Background: Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
• Synonyms: AMCBX2; CGD; GP91-1; GP91-PHOX; GP91PHOX; IMD34; NOX2; p91-PHOX
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Horse: 86%; Bovine: 85%; Pig: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane
• Protein Pathways: Leukocyte transendothelial migration